Recombinant Human Peroxiredoxin-1 (PRDX1)

In Stock Promotion
Code CSB-EP018653HU
MSDS
Size US$306
Order now
Promotion
Promotional price as low as $99
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Heme binding 23 kDa protein; MSP23; Natural killer cell-enhancing factor A; NKEF A; NKEF-A; NKEFA; OSF3; Osteoblast specific factor 3; PAG; Paga; PAGB; Peroxiredoxin 1; Peroxiredoxin-1; PRDX1; PRDX1_HUMAN; Proliferation associated gene A ; Proliferation-associated gene protein; PRX1; PrxI; TDPX2; Thioredoxin peroxidase 2; Thioredoxin-dependent peroxide reductase 2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-199aa
Target Protein Sequence
MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
27.6 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation.
Gene References into Functions
  1. Even low doses of radiation employed for dental purposes are capable to provoke stress to cells, which was demonstrated via the induction of the antioxidant gene PRDX1. In elderly patients, such mechanism was demonstrated to be impaired. PMID: 29063384
  2. PRDX1 expression is low in osteosarcoma and fibrosarcoma tumors. PRDX1 suppressed the progression and metastasis of osteosarcoma and fibrosarcoma cells. PMID: 29908016
  3. that Peroxiredoxin1 expression predicted poor prognosis by regulating the tumor metastasis and angiogenesis of colorectal cancer PMID: 29673884
  4. The mRNA and protein levels of Prdx1 in the GC tissues were higher than in the peri-tumor tissues. Authors also found that high Prdx1 expression was positively correlated with the lymph node invasion and poor prognosis. PMID: 29656298
  5. these data ascertain the existence of an H2O2-sensitive PRDX1-FOXO3 signaling axis that fine tunes FOXO3 activity toward the transcription of gene targets in response to oxidative stress. PMID: 28398822
  6. Study uncovered a novel interaction between APE1 and PRDX1, which existed in both the nuclear and cytosolic fractions. Its knockdown enhances APE1 detection in the nucleus and stimulates IL-8 expression. Also, in gastric cancer patients, PRDX1 mRNA expression level is reduced and correlates with poor survival. PMID: 27388124
  7. Median PRDX1 levels were significantly higher in stroke patients compared to controls. PMID: 27924073
  8. The epimutation is present in three generations and results from PRDX1 mutations that force antisense transcription of MMACHC. PMID: 29302025
  9. Peroxiredoxin I (Prx I) increased in tumors of hepatocellular carcinoma (HCC) patients that aligned with overexpression of oncogenic H-ras. PMID: 27517622
  10. Prx1 might play an oncogenic role in tobacco-related oral squamous cell carcinoma and thus serve as a target for chemopreventive and therapeutic interventions. PMID: 27259998
  11. PRDX1 safeguards telomeres from oxygen radicals to counteract telomere damage and preserve telomeric DNA for elongation by telomerase. PMID: 28009281
  12. infection results in S-nitrosylation of multiple host proteins, including Prx1. PMID: 27612662
  13. circulating Prdx1 provides not only prognostic information but may be a promising target against ischemia/reperfusion injury. PMID: 27142532
  14. our findings suggest that the tumor suppressor activity of SIRT2 requires its ability to restrict the antioxidant activity of Prdx-1, thereby sensitizing breast cancer cells to reactive oxygen species -induced DNA damage and cell cytotoxicity PMID: 27503926
  15. UV-vis spectra of heme-PRX1 suggested that Cys52 is the axial ligand of ferric heme. PRX1 peroxidase activity was lost upon heme binding, reflecting the fact that Cys52 is not only the heme-binding site but also the active center of peroxidase activity. PMID: 28082197
  16. Prx1 and Prx2 are likely targets of urate hydroperoxide in cells. Oxidation of Prxs by urate hydroperoxide might affect cell function and be partially responsible for the pro-oxidant and pro-inflammatory effects of uric acid. PMID: 28348082
  17. Data suggest that PRX1 is a dual-function enzyme exhibiting both thioredoxin peroxidase-like activity and catalase-like activity with varied affinities towards reactive oxygen species; studies were conducted using recombinant proteins from green spotted puffer fish Tetraodon nigroviridis and from human. PMID: 28219939
  18. peroxiredoxin 1 has a role in redox sensing and transducing [review] PMID: 27756681
  19. Activation of PRX1 and -2 indicate cold atmospheric plasma affects redox homeostasis in osteosarcoma cells PMID: 28314261
  20. Data show that peroxiredoxins PRDX1 and PRDX2 are upregulated in tumor B cells as compared with normal counterparts. PMID: 26636537
  21. Data show the protein partners of human Prx1 and Prx2 and identified three sequence motifs, or combination thereof in Prxs partners, namely: CXXC, PXXP, and LXXLL. that can be important for protein localization, function and biological pathways. [review] PMID: 26548861
  22. The data indicate that Prdx1 may contribute to the development and progression of hilar cholangiocarcinoma PMID: 26617696
  23. Our data suggest that PRX1 inactivation could represent an interesting strategy to enhance cancer cell sensitivity to vitK3, providing a potential new therapeutic perspective for this old molecule. PMID: 26689287
  24. TRX-1/PRX-1 levels are associated with NADPH oxidase-activity in vivo and in vitro in atherosclerosis. PMID: 26117319
  25. PRDX1 was overexpressed in the tumor tissues of liver cancer and served as an independent poor prognostic factor for overall survival. PRDX1 can be modified by small ubiquitin-like modifier to play specific roles in hepatocarcinogenesis. PMID: 26478675
  26. The immunohistochemistry-based validation using tissue microarray slides in oral squamous cell carcinoma revealed overexpression of the RAB2A and PRDX1 gene in 80 and 68 % of the tested clinical cases, respectively. PMID: 26159854
  27. the protein and mRNA levels of PRDX1 were significantly elevated under insulin-resistant conditions PMID: 26301632
  28. Prdx1 associates with the formation of membrane protrusions through modulation of the activity of p38 MAPK, which in turn promotes pancreatic ductal adenocarcinoma cell invasion. PMID: 25426613
  29. These findings that Prdx1 may be involved in tumorigenesis in esophageal squamous cell carcinoma PMID: 25579166
  30. Dephosphorylation of PrxI by okadaic acid-sensitive phosphatases during late mitosis again shields the centrosome from H2O2 and thereby allows the reactivation of Cdk1-opposing phosphatases at the organelle. PMID: 26150388
  31. This review will summarize the molecular basis of differences in the affinity of Srx for individual Prx and the role of individual component of the Srx-Prx system in tumor progression and metastasis. PMID: 26170166
  32. Overexpression of PRDX1 resulted in a higher resistance of cells to BCNU treatment PMID: 25484280
  33. PRDX1 is shown to be an independent predictor of improved outcomes in ER-positive breast cancer. PMID: 25011585
  34. The K(27)-acetylated hPrx1 exhibited greatly enhanced chaperone activity (e.g. protecting the protein malate dehydrogenase (MDH) from thermally induced aggregation and assisting the refolding of denatured citrate synthase). PMID: 25082442
  35. High level of PRDX1 expression is associated with lymph node metastasis and lung tumor differentiation. PMID: 23914992
  36. MicroRNA-510 promotes cell and tumor growth by targeting peroxiredoxin1 in breast cancer. PMID: 23971998
  37. because of the lower amount of total PRDX1 and PRDX6 and the high thiol oxidation of these PRDXs, very little (less than 20%) protection due to PRDXs remains in infertile men, and this is associated with impaired sperm function and poor DNA integrity PMID: 22492841
  38. Hypoexpression of PRDX1 is associated with papillary thyroid carcinomas. PMID: 24316730
  39. increased Prdx1 expression is associated with tumor angiogenesis and progression in hepatocellular carcinoma PMID: 24297309
  40. results suggest that NGF-trkA signaling is involved in mechanical allodynia in paclitaxel-induced neuropathy PMID: 24480440
  41. The data indicate that Prdx1 may contribute to malignant transformation of the esophagus, and may be used as a biomarker in the immunodiagnosis of ESCC. PMID: 24009050
  42. cellular distribution of Peroxiredoxin I and II in human eyes PMID: 24152995
  43. Thioredoxin 1 is inactivated due to oxidation induced by peroxiredoxin under oxidative stress and reactivated by the glutaredoxin system. PMID: 24062305
  44. Our findings suggest that Prx1 may modulate the chemosensitivity of lung cancer to docetaxel through suppression of FOXO1-induced apoptosis. PMID: 23615915
  45. Prdx1 orchestrates redox signaling in an H2O2 dose-dependent manner through the oxidation status of its peroxidatic cysteine Cys52. PMID: 23334324
  46. Data indicate that AMP-dependent kinases (AMPKalpha1 and AMPKalpha2) inhibit caveolin-1 phosphorylation by stabilizing the interaction between c-Abl and Prdx-1. PMID: 23723070
  47. study identified Pin1 as a novel PRDX1 binding protein and proposed a mechanism for Pin1 in regulating the metabolism of reactive oxygen species in cells PMID: 23421996
  48. expression of Prxs I and IV, both at mRNA and protein levels, was associated with light chain secretion quantified by ELISA. PMID: 23737084
  49. observations suggest that PRDX1 acts as a pro-cancer protein in HCC HepG2 cells. PMID: 23277276
  50. The protein and mRNA expressions of Prx1 and Prx6 increased significantly in the order of normal brain tissue, grade II astrocytoma, grade III astrocytoma and grade IV astrocytoma. PMID: 22985558

Show More

Hide All

Subcellular Location
Cytoplasm. Melanosome. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Protein Families
Peroxiredoxin family, AhpC/Prx1 subfamily
Database Links

HGNC: 9352

OMIM: 176763

KEGG: hsa:5052

STRING: 9606.ENSP00000262746

UniGene: Hs.180909

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*